WHAT IF Check report

This file was created 2007-05-14 from WHAT_CHECK output by a conversion script. If you are new to WHAT_CHECK, please study the pdbreport pages. There also exists a legend to the output.

Verification log for pdb104l.ent

Sect 0) Symmetry related problems

Note: Non crystallographic symmetry RMS plot

The plot shows the RMS differences between two similar chains on a residue-by-residue basis. Individual "spikes" can be indicative of interesting or wrong residues. If all residues show a high RMS value, the structure could be incorrectly refined.

Chain identifiers of the two chains: A and B

All-atom RMS fit for the two chains : 1.105
CA-only RMS fit for the two chains : 0.508

Note: Non crystallographic symmetry backbone difference plot

The plot shows the differences in backbone torsion angles between two similar chains on a residue-by-residue basis. Individual "spikes" can be indicative of interesting or wrong residues. If all residues show high differences, the structure could be incorrectly refined.

Chain identifiers of the two chains: A and B

Note: No crystallographic symmetry between molecules

No extra crystallographic symmetry was observed between the independent molecules.

Note: Matthews coefficient OK

The Matthews coefficient [REF] is defined as the density of the protein structure in cubic Angstroms per Dalton. Normal values are between 1.5 (tightly packed, little room for solvent) and 4.0 (loosely packed, much space for solvent). Some very loosely packed structures can get values a bit higher than that.

Molecular weight of all polymer chains: 36996.816
Volume of the Unit Cell V= 2052018.9
Cell multiplicity: 18
Matthews coefficient for observed atoms Vm= 3.081

Note: All atoms are sufficiently far away from symmetry axes

None of the atoms in the structure is closer than 0.77 Angstrom to a proper symmetry axis.

Sect 1) Administrative problems that can generate validation failures

Note: No strange inter-chain connections detected

No covalent bonds have been detected between molecules with non-identical chain identifiers.

Note: No duplicate atom names in ligands

All atom names in ligands seem adequately unique.

Note: No mixed usage of alternate atom problems detected

Either this structure does not contain alternate atoms, or they have not been mixed up, or the errors have remained unnoticed.

Note: In all cases the primary alternate atom was used

WHAT IF saw no need to make any alternate atom corrections (which means they are all correct, or there arent any).

Note: No overlapping non-alternates detected

Either this structure does not contain overlapping non-alternate atoms, or they are all correct, or the errors have remained unnoticed.

Note: No residues detected inside ligands

Either this structure does not contain ligands with amino acid groups in it, or their naming is proper (enough).

Note: Ligand topologies OK

The topology could be determined for all ligands (or there are no ligands for which a topology is needed, in which case there is absolutely no problem, of course). That is good because it means that all ligands can be included in the hydrogen bond optimization and related options.

Note: No attached groups interfere with hydrogen bond calculations

It seems there are no sugars, lipids, etc., bound (very close) to atoms that otherwise could form hydrogen bonds.

Note: No atoms with high occupancy detected at special positions

Either there were no atoms at special positions, or all atoms at special positions have adequately reduced occupancies.

Note: All residues have a complete backbone.

No residues have missing backbone atoms.

Note: No probable atoms with zero occupancy detected.

Either there are no atoms with zero occupancy, or they are not present in the file, or their positions are sufficiently improbable to warrant a zero occupancy.

Sect 2) Non-validating, descriptive output paragraph

Note: Content of the PDB file as interpreted by WHAT IF

Content of the PDB file as interpreted by WHAT IF WHAT IF has read your PDB file, and stored it internally in what is called 'the soup'. The content of this soup is listed here. An extensive explanation of all frequently used WHAT IF output formats can be found at http://swift.cmbi.ru.nl/. Look under output formats.

     1     1 (    1)   164 (  162) A Protein             pdb104l.ent
     2   165 (    1)   328 (  162) B Protein             pdb104l.ent
     3   329 ( HOH )   329 ( HOH )   water   (   32)     pdb104l.ent

Note: Ramachandran plot

In this Ramachandran plot X-signs represent glycines, squares represent prolines and plus-signs represent the other residues. If too many plus-signs fall outside the contoured areas then the molecule is poorly refined (or worse).

In a colour picture, the residues that are part of a helix are shown in blue, strand residues in red. "Allowed" regions for helical residues are drawn in blue, for strand residues in red, and for all other residues in green.

Chain identifier: A

Note: Ramachandran plot

Chain identifier: B

Note: Secondary structure

This is the secondary structure according to DSSP. Only helix (H), overwound or 3/10-helix (3), strand (S), turn (T) and coil (blank) are shown. [REF]. All DSSP related information can be found at the DSSP page. This is not really a structure validation option, but a very scattered secondary structure (i.e. many strands of only a few residues length, many Ts inside helices, etc) tends to indicate a poor structure.
                     10        20        30        40        50        60
                      |         |         |         |         |         |
    1 -  60  MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVI
(   1)-(  58)  HHHHHHHHT   T  SS TTT SSSTTTSSSS  TT  HHHHHHHHHHHHTT  TT
                     70        80        90       100       110       120
                      |         |         |         |         |         |
   61 - 120  TKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL
(  59)-( 118) HHHHHHHHHHHHHHHHHHHTT TTTHHHHHHT HHHHHHHHHHHHHHHHHHHHT HHHH
                    130       140       150       160
                      |         |         |         |
  121 - 164  RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
( 119)-( 162)HHTTTT HHHHHHHTTTTHHHHHTHHHHHHHHHHHHHTTT333
                170       180       190       200       210       220
                  |         |         |         |         |         |
  165 - 224  MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVI
(   1)-(  58)  HHHHHHHHH   T  SS TTT SS TTT      TT  HHHHHHHHHHHT T  TT
                230       240       250       260       270       280
                  |         |         |         |         |         |
  225 - 284  TKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL
(  59)-( 118) HHHHHHHHHHHHHHHHHHHHT TTHHHHHHHT TTHHHHHHHHHHHH HHHHHH HHHH
                290       300       310       320
                  |         |         |         |
  285 - 328  RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
( 119)-( 162)HHHHTT TTHHHHHHTTTHHHHHT HHHHHHHHHHHT T3333
 
 
 

Sect 3) Coordinate problems, unexpected atoms, B-factor and occupancy checks

Note: No rounded coordinates detected

No significant rounding of atom coordinates has been detected.

Note: No artificial side chains detected

No artificial side-chain positions characterized by chi-1=0.00 or chi-1=180.00 have been detected.

Note: No missing atoms detected in residues

All expected atoms are present in residues. This validation option has not looked at 'things' that can or should be attached to the elemantary building blocks (amino acids, nucleotides). Even the C-terminal oxygens are treated separately.

Note: No C-terminal nitrogen detected

It is becoming habit to indicate that a residue is not the true C-terminus by including only the backbone N of the next residue. This has not been observed in this PDB file.

Note: Test capping of (pseudo) C-termini

No extra capping groups were found on pseudo C-termini. This can imply that no pseudo C-termini are present.

Error: C-terminal group missing

The residues listed below are true C-terminal groups that are missing a C-terminal capping group (OXT, post-translational modification, or backbone N of next residue)

 164 LYS  ( 162 ) A
 328 LYS  ( 162 ) B

Note: No OXT found in the middle of chains

No C-terminal OXT groups were found in the middle of protein chains.

Note: Weights checked OK

All atomic occupancy factors ('weights') fall in the 0.0--1.0 range.

Note: Normal distribution of occupancy values

The distribution of the occupancy values in this file seems 'normal'.

Be aware that this evaluation is merely the result of comparing this file with about 500 well-refined high-resolution files in the PDB. If this file has much higher or much lower resolution than the PDB files used in WHAT IF's trainig set, non-normal values might very well be perfectly fine, or normal values might actually be not so normal...

Note: All occupancies seem to add up to 1.0.

In principle, the occupancy of all alternates of one atom should add up till 1.0. A valid exception is the missing atom (i.e. an atom not seen in the electron density) that is allowed to have a 0.0 occupancy.

Warning: Average B-factor problem

The average B-factor for all buried protein atoms normally lies between 10--20. Values around 3--5 are expected for X-ray studies performed at liquid nitrogen temperature.

Because of the extreme value for the average B-factor, no further analysis of the B-factors is performed.

Average B-factor for buried atoms : 43.737

Note: B-factor plot

The average atomic B-factor per residue is plotted as function of the residue number.

Chain identifier: A

Note: B-factor plot

Chain identifier: B

Sect 4) Nomenclature related problems

Note: Valine nomenclature OK

No errors were detected in valine nomenclature.

Note: Threonine nomenclature OK

No errors were detected in threonine nomenclature.

Note: Isoleucine nomenclature OK

No errors were detected in isoleucine nomenclature.

Note: Leucine nomenclature OK

No errors were detected in leucine nomenclature.

Note: Arginine nomenclature OK

No errors were detected in arginine nomenclature.

Note: Tyrosine torsion conventions OK

No errors were detected in tyrosine torsion angle conventions.

Note: Phenylalanine torsion conventions OK

No errors were detected in phenylalanine torsion angle conventions.

Note: Aspartic acid torsion conventions OK

No errors were detected in aspartic acid torsion angle conventions.

Note: Glutamic acid torsion conventions OK

No errors were detected in glutamic acid torsion angle conventions.

Note: Heavy atom naming OK

No errors were detected in the atom names for non-hydrogen atoms.

Note: Chain names are OK

All chain names assigned to polymer molecules are unique, and all residue numbers are strictly increasing within each chain.

Sect 5) Geometric checks

Warning: Unusual bond lengths

The bond lengths listed in the table below were found to deviate more than 4 sigma from standard bond lengths (both standard values and sigma for amino acid residues have been taken from Engh and Huber [REF], for DNA they were taken from Parkinson et al [REF]). In the table below for each unusual bond the bond length and the number of standard deviations it differs from the normal value is given.

Atom names starting with "-" belong to the previous residue in the chain. If the second atom name is "--SS", the disulphide bridge has a deviating length.

  41 ALA  (  41 ) A      N   -C     1.230  -5.0
  64 GLU  (  62 ) A      CD   OE2   1.325   4.0
  66 GLU  (  64 ) A      CD   OE2   1.333   4.4
  94 ASP  (  92 ) A      CG   OD2   1.334   4.5
 110 GLU  ( 108 ) A      CA   C     1.426  -4.7
 130 GLU  ( 128 ) A      CD   OE2   1.336   4.6
 161 ASP  ( 159 ) A      CG   OD1   1.332   4.4
 227 ASP  (  61 ) B      CG   OD1   1.328   4.1
 236 ASP  (  70 ) B      CG   OD2   1.334   4.4
 274 GLU  ( 108 ) B      CD   OE1   1.330   4.3
 294 GLU  ( 128 ) B      CD   OE2   1.330   4.2

Note: Normal bond length variability

Bond lengths were found to deviate normally from the standard bond lengths (values for Protein residues were taken from Engh and Huber [REF], for DNA/RNA from Parkinson et al [REF]).

RMS Z-score for bond lengths: 1.113
RMS-deviation in bond distances: 0.023

Warning: Possible cell scaling problem

Comparison of bond distances with Engh and Huber [REF] standard values for protein residues and Parkinson et al [REF] values for DNA/RNA shows a significant systematic deviation. It could be that the unit cell used in refinement was not accurate enough. The deformation matrix given below gives the deviations found: the three numbers on the diagonal represent the relative corrections needed along the A, B and C cell axis. These values are 1.000 in a normal case, but have significant deviations here (significant at the 99.99 percent confidence level)

There are a number of different possible causes for the discrepancy. First the cell used in refinement can be different from the best cell calculated. Second, the value of lambda used for a synchrotron data set can be miscalibrated. Finally, the discrepancy can be caused by a dataset that has not been corrected for significant anisotropic thermal motion.

Please note that the proposed scale matrix has NOT been constrained to obey the space group symmetry. This is done on purpose. The distortions can give you an indication of the accuracy of the determination.

Unit Cell deformation matrix

 |  1.003013  0.000893 -0.001402|
 |  0.000893  1.002779  0.000555|
 | -0.001402  0.000555  1.001635|
Proposed new scale matrix

 |  0.005791  0.003341  0.000006|
 | -0.000006  0.006690 -0.000004|
 |  0.000017 -0.000007  0.012480|
With corresponding cell

    A    = 172.606  B   = 172.468  C    =  80.131
    Alpha=  89.865  Beta=  90.160  Gamma= 119.929

The CRYST1 cell dimensions

    A    = 172.100  B   = 172.100  C    =  80.000
    Alpha=  90.000  Beta=  90.000  Gamma= 120.000

Variance: 72.753
(Under-)estimated Z-score: 6.286

Warning: Unusual bond angles

The bond angles listed in the table below were found to deviate more than 4 sigma from standard bond angles (both standard values and sigma for protein residues have been taken from Engh and Huber [REF], for DNA/RNA from Parkinson et al [REF]). In the table below for each strange angle the bond angle and the number of standard deviations it differs from the standard values is given. Please note that disulphide bridges are neglected. Atoms starting with "-" belong to the previous residue in the sequence.

   4 PHE  (   4 ) A      CA   CB   CG  108.470  -5.3
   6 MET  (   6 ) A      N    CA   CB  102.973  -4.4
  17 ILE  (  17 ) A      CB   CG1  CD1 101.793  -5.7
  20 ASP  (  20 ) A      CA   CB   CG  116.656   4.1
  25 TYR  (  25 ) A      CA   CB   CG  104.776  -4.6
  31 HIS  (  31 ) A      N    CA   CB  117.648   4.2
  33 LEU  (  33 ) A     -O   -C    N   130.061   4.4
  33 LEU  (  33 ) A     -CA  -C    N   107.355  -4.4
  36 SER  (  36 ) A      CA   C    O   113.665  -4.2
  37 PRO  (  37 ) A     -O   -C    N   128.068   4.3
  37 PRO  (  37 ) A      N    CA   CB  110.105   6.5
  40 ASN  (  40 ) A      CA   CB   CG  116.721   4.1
  41 ALA  (  41 ) A     -O   -C    N   133.563   6.6
  41 ALA  (  41 ) A     -CA  -C    N   105.509  -5.3
  49 ASP  (  47 ) A      CA   CB   CG  108.147  -4.5
  56 THR  (  54 ) A      CA   CB   OG1 102.421  -4.8
  59 VAL  (  57 ) A      CA   CB   CG1 102.581  -4.7
  60 ILE  (  58 ) A     -C    N    CA  113.663  -4.5
  70 ASN  (  68 ) A      CA   CB   CG  119.494   6.9
  72 ASP  (  70 ) A      N    CA   CB  121.198   6.3
  72 ASP  (  70 ) A      C    CA   CB  118.850   4.6
  74 ASP  (  72 ) A      CA   CB   CG  121.287   8.7
  78 ARG  (  76 ) A      CG   CD   NE  118.010   4.4
  86 LEU  (  84 ) A      N    CA   CB  117.433   4.1
  91 ASP  (  89 ) A      CA   CB   CG  107.361  -5.2
And so on for a total of 69 lines.

Note: Normal bond angle variability

Bond angles were found to deviate normally from the mean standard bond angles (normal values for protein residues were taken from Engh and Huber [REF], for DNA/RNA from Parkinson et al [REF]). The RMS Z-score given below is expected to be around 1.0 for a normally restrained data set, and this is indeed observed for very high resolution X-ray structures. More common values are around 1.55.

RMS Z-score for bond angles: 1.565
RMS-deviation in bond angles: 2.973

Warning: Chirality deviations detected

The atoms listed in the table below have an improper dihedral value that is deviating from expected values. As the improper dihedral values are all getting very close to ideal values in recent X-ray structures, and as we actually don't know how big the spread around these values should be, this check only warns for 6 sigma deviations.

Improper dihedrals are a measure of the chirality/planarity of the structure at a specific atom. Values around -35 or +35 are expected for chiral atoms, and values around 0 for planar atoms. Planar side chains are left out of the calculations, these are better handled by the planarity checks.

Three numbers are given for each atom in the table. The first is the Z-score for the improper dihedral. The second number is the measured improper dihedral. The third number is the expected value for this atom type. A final column contains an extra warning if the chirality for an atom is opposite to the expected value.

   3 ILE  (   3 ) A    CA        -6.1     22.7     34.1
  72 ASP  (  70 ) A    CA       -10.5     13.4     34.0
 118 ASN  ( 116 ) A    CA       -10.8     13.3     34.2
 122 MET  ( 120 ) A    CA         6.3     45.5     34.5
 127 ARG  ( 125 ) A    CA        -7.4     21.0     34.3
 154 THR  ( 152 ) A    CA        -6.6     22.1     34.3
 172 ARG  (   8 ) B    CA        -8.3     19.5     34.3
 180 LYS  (  16 ) B    CA        -6.6     23.1     34.3
 195 HIS  (  31 ) B    CA        -7.5     21.8     34.7
 230 GLU  (  64 ) B    CA        -7.1     23.2     34.4
 290 LYS  ( 124 ) B    CA       -11.5     14.9     34.3
 292 TRP  ( 126 ) B    CA        -6.1     24.6     34.7
 309 PRO  ( 143 ) B    N         -6.5    -40.7     -2.1
 326 ALA  ( 160 ) B    CA        -6.3     26.2     34.5

Note: Improper dihedral angle distribution OK

The RMS Z-score for all improper dihedrals in the structure is within normal ranges.

Improper dihedral RMS Z-score : 1.982

Error: Side chain planarity problems

The side chains of the residues listed in the table below contain a planar group that was found to deviate from planarity by more than 4.0 times the expected value. For an amino acid residue that has a side chain with a planar group, the RMS deviation of the atoms to a least squares plane was determined. The number in the table is the number of standard deviations this RMS value deviates from the expected value (0.0).

 227 ASP  (  61 ) B   4.534
 267 ASN  ( 101 ) B   4.490

Note: Atoms connected to aromatic rings OK

All of the atoms that are connected to planar aromatic rings in side chains of amino-acid residues are in the plane within expected RMS deviations.

Sect 6) Torsion-related checks

Warning: Unusual PRO puckering amplitudes

The proline residues listed in the table below have a puckering amplitude that is outside of normal ranges. Puckering parameters were calculated by the method of Cremer and Pople [REF]. Normal PRO rings have a puckering amplitude Q between 0.20 and 0.45 Angstrom. If Q is lower than 0.20 Angstrom for a PRO residue, this could indicate disorder between the two different normal ring forms (with C-gamma below and above the ring, respectively). If Q is higher than 0.45 Angstrom something could have gone wrong during the refinement. Be aware that this is a warning with a low confidence level. See: Who checks the checkers? Four validation tools applied to eight atomic resolution structures. K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al. J.Mol.Biol. (1998) 276,417-436.

  37 PRO  (  37 ) A   0.19 LOW
  88 PRO  (  86 ) A   0.13 LOW
 252 PRO  (  86 ) B   0.17 LOW
 309 PRO  ( 143 ) B   0.18 LOW

Warning: Unusual PRO puckering phases

The proline residues listed in the table below have a puckering phase that is not expected to occur in protein structures. Puckering parameters were calculated by the method of Cremer and Pople [REF]. Normal PRO rings approximately show a so-called envelope conformation with the C-gamma atom above the plane of the ring (phi=+72 degrees), or a half-chair conformation with C-gamma below and C-beta above the plane of the ring (phi=-90 degrees). If phi deviates strongly from these values, this is indicative of a very strange conformation for a PRO residue, and definitely requires a manual check of the data. Be aware that this is a warning with a low confidence level. See: Who checks the checkers? Four validation tools applied to eight atomic resolution structures. K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al. J.Mol.Biol. (1998) 276,417-436.

 145 PRO  ( 143 ) A    4.5 envelop N (0 degrees)

Warning: Torsion angle evaluation shows unusual residues

The residues listed in the table below contain bad or abnormal torsion angles.

These scores give an impression of how `normal' the torsion angles in protein residues are. All torsion angles except omega are used for calculating a `normality' score. Average values and standard deviations were obtained from the residues in the WHAT IF database. These are used to calculate Z-scores. A residue with a Z-score of below -2.0 is poor, and a score of less than -3.0 is worrying. For such residues more than one torsion angle is in a highly unlikely position.

 117 THR  ( 115 ) A -3.4044
 182 TYR  (  18 ) B -2.8440
 181 ILE  (  17 ) B -2.7865
 218 ARG  (  52 ) B -2.7620
 251 LYS  (  85 ) B -2.7304
   3 ILE  (   3 ) A -2.7278
 191 ILE  (  27 ) B -2.6888
 185 THR  (  21 ) B -2.6664
   9 ILE  (   9 ) A -2.6014
  27 ILE  (  27 ) A -2.4852
 216 ILE  (  50 ) B -2.4310
 199 LYS  (  35 ) B -2.4022
 198 THR  (  34 ) B -2.3370
  34 THR  (  34 ) A -2.2955
 128 TRP  ( 126 ) A -2.2878
  54 ARG  (  52 ) A -2.2532
 224 ILE  (  58 ) B -2.2364
 290 LYS  ( 124 ) B -2.2050
 266 ILE  ( 100 ) B -2.2047
 309 PRO  ( 143 ) B -2.1999
 175 GLU  (  11 ) B -2.1441
 320 ARG  ( 154 ) B -2.1258
 316 ILE  ( 150 ) B -2.1159
 108 MET  ( 106 ) A -2.1123
 187 GLY  (  23 ) B -2.0862
  50 LYS  (  48 ) A -2.0602
 122 MET  ( 120 ) A -2.0419
 177 LEU  (  13 ) B -2.0414
 321 THR  ( 155 ) B -2.0251
 257 LEU  (  91 ) B -2.0156
 111 THR  ( 109 ) A -2.0109

Warning: Backbone torsion angle evaluation shows unusual conformations

The residues listed in the table below have abnormal backbone torsion angles.

Residues with `forbidden' phi-psi combinations are listed, as well as residues with unusual omega angles (deviating by more than 3 sigma from the normal value). Please note that it is normal if about 5 percent of the residues is listed here as having unusual phi-psi combinations.

   2 ASN  (   2 ) A Poor phi/psi
  34 THR  (  34 ) A Poor phi/psi
  37 PRO  (  37 ) A Poor PRO-phi
  54 ARG  (  52 ) A Poor phi/psi
  57 ASN  (  55 ) A Poor phi/psi
  80 ILE  (  78 ) A Poor phi/psi
 117 THR  ( 115 ) A Poor phi/psi
 126 LYS  ( 124 ) A Poor phi/psi
 145 PRO  ( 143 ) A Poor PRO-phi
 159 THR  ( 157 ) A Poor phi/psi
 181 ILE  (  17 ) B Poor phi/psi
 182 TYR  (  18 ) B Poor phi/psi
 187 GLY  (  23 ) B Poor phi/psi
 191 ILE  (  27 ) B Poor phi/psi
 198 THR  (  34 ) B Poor phi/psi
 201 PRO  (  37 ) B Poor PRO-phi
 202 SER  (  38 ) B Poor phi/psi
 218 ARG  (  52 ) B Poor phi/psi
 221 ASN  (  55 ) B Poor phi/psi
 236 ASP  (  70 ) B Poor phi/psi
 258 ASP  (  92 ) B Poor phi/psi
 280 PHE  ( 114 ) B Poor phi/psi
 281 THR  ( 115 ) B Poor phi/psi
 290 LYS  ( 124 ) B Poor phi/psi
 309 PRO  ( 143 ) B Poor phi/psi
 321 THR  ( 155 ) B Poor phi/psi
 322 GLY  ( 156 ) B Poor phi/psi
 324 TRP  ( 158 ) B Poor phi/psi

Error: Ramachandran Z-score very low

The score expressing how well the backbone conformations of all residues are corresponding to the known allowed areas in the Ramachandran plot is very low.

Ramachandran Z-score : -6.501

Warning: Omega angles too tightly restrained

The omega angles for trans-peptide bonds in a structure are expected to give a gaussian distribution with the average around +178 degrees and a standard deviation around 5.5 degrees. These expected values were obtained from very accurately determined structures. Many protein structures are too tightly constrained. This seems to be the case with the current structure, as the observed standard deviation is below 4.0 degrees.

Standard deviation of omega values : 0.511

Error: chi-1/chi-2 angle correlation Z-score very low

The score expressing how well the chi-1/chi-2 angles of all residues are corresponding to the populated areas in the database is very low.

chi-1/chi-2 correlation Z-score : -5.647

Warning: Backbone oxygen evaluation

The residues listed in the table below have an unusual backbone oxygen position.

For each of the residues in the structure, a search was performed to find 5-residue stretches in the WHAT IF database with superposable C-alpha coordinates, and some constraints on the neighboring backbone oxygens.

In the following table the RMS distance between the backbone oxygen positions of these matching structures in the database and the position of the backbone oxygen atom in the current residue is given. If this number is larger than 1.5 a significant number of structures in the database show an alternative position for the backbone oxygen. If the number is larger than 2.0 most matching backbone fragments in the database have the peptide plane flipped. A manual check needs to be performed to assess whether the experimental data can support that alternative as well. The number in the last column is the number of database hits (maximum 80) used in the calculation. It is "normal" that some glycine residues show up in this list, but they are still worth checking!

 321 THR  ( 155 ) B  1.65   23
 213 ASP  (  47 ) B  1.59   80
 258 ASP  (  92 ) B  1.57   19

Warning: Unusual rotamers

The residues listed in the table below have a rotamer that is not seen very often in the database of solved protein structures. This option determines for every residue the position specific chi-1 rotamer distribution. Thereafter it verified whether the actual residue in the molecule has the most preferred rotamer or not. If the actual rotamer is the preferred one, the score is 1.0. If the actual rotamer is unique, the score is 0.0. If there are two preferred rotamers, with a population distribution of 3:2 and your rotamer sits in the lesser populated rotamer, the score will be 0.667. No value will be given if insufficient hits are found in the database.

It is not necessarily an error if a few residues have rotamer values below 0.3, but careful inspection of all residues with these low values could be worth it.

 167 ILE  (   3 ) B   0.37

Warning: Unusual backbone conformations

For the residues listed in the table below, the backbone formed by itself and two neighboring residues on either side is in a conformation that is not seen very often in the database of solved protein structures. The number given in the table is the number of similar backbone conformations in the database with the same amino acid in the center.

For this check, backbone conformations are compared with database structures using C-alpha superpositions with some restraints on the backbone oxygen positions.

A residue mentioned in the table can be part of a strange loop, or there might be something wrong with it or its directly surrounding residues. There are a few of these in every protein, but in any case it is worth looking at!

  29 ILE  (  29 ) A  0
 160 TRP  ( 158 ) A  0
 163 TYR  ( 161 ) A  0
 164 LYS  ( 162 ) A  0
 165 MET  (   1 ) B  0
 166 ASN  (   2 ) B  0
 193 ILE  (  29 ) B  0
 221 ASN  (  55 ) B  0
 108 MET  ( 106 ) A  1
 118 ASN  ( 116 ) A  1
 137 LYS  ( 135 ) A  1
 191 ILE  (  27 ) B  2
 216 ILE  (  50 ) B  2
 220 THR  (  54 ) B  2
 272 MET  ( 106 ) B  2
 301 LYS  ( 135 ) B  2
 324 TRP  ( 158 ) B  2

Note: Backbone conformation Z-score OK

The backbone conformation analysis gives a score that is normal for well refined protein structures.

Backbone conformation Z-score : -1.826

Sect 7) Bump checks

Error: Abnormally short interatomic distances

The pairs of atoms listed in the table below have an unusually short distance.

The contact distances of all atom pairs have been checked. Two atoms are said to `bump' if they are closer than the sum of their Van der Waals radii minus 0.40 Angstrom. For hydrogen bonded pairs a tolerance of 0.55 Angstrom is used. The first number in the table tells you how much shorter that specific contact is than the acceptable limit. The second distance is the distance between the centers of the two atoms. Although we believe that two water atoms at 2.4 A distance are too close, we only report water pairs that are closer than this rather short distance.

The last text-item on each line represents the status of the atom pair. The text `INTRA' means that the bump is between atoms that are explicitly listed in the PDB file. `INTER' means it is an inter-symmetry bump. If the final column contains the text 'HB', the bump criterium was relaxed because there could be a hydrogen bond. Similarly relaxed criteria are used for 1--3 and 1--4 interactions (listed as 'B2' and 'B3', respectively). If the last column is 'BF', the sum of the B-factors of the atoms is higher than 80, which makes the appearance of the bump somewhat less severe because the atoms probably aren't there anyway.

Bumps between atoms for which the sum of their occupancies is lower than one are not reported. In any case, each bump is listed in only one direction.

  87 LYS  (  85 ) A    NZ    --   87 LYS  (  85 ) A    NZ      0.863   2.137 INTER
  40 ASN  (  40 ) A    ND2   --   43 LYS  (  43 ) A    CE      0.736   2.364 INTRA BF
 203 LEU  (  39 ) B    CD2   --  207 LYS  (  43 ) B    CG      0.533   2.667 INTRA BF
  78 ARG  (  76 ) A    NE    --   98 ARG  (  96 ) A    NH2     0.526   2.474 INTER BF
  43 LYS  (  43 ) A    NZ    --  301 LYS  ( 135 ) B    CB      0.487   2.613 INTRA BF
 261 ARG  (  95 ) B    NE    --  292 TRP  ( 126 ) B    CE3     0.372   2.728 INTRA BF
 242 ARG  (  76 ) B    NE    --  262 ARG  (  96 ) B    NH1     0.356   2.644 INTER BF
 201 PRO  (  37 ) B    O     --  203 LEU  (  39 ) B    N       0.346   2.354 INTRA BF
  50 LYS  (  48 ) A    CG    --   51 ALA  (  49 ) A    N       0.334   2.766 INTRA BF
 181 ILE  (  17 ) B    N     --  191 ILE  (  27 ) B    CD1     0.326   2.774 INTRA BF
 316 ILE  ( 150 ) B    CG2   --  317 THR  ( 151 ) B    N       0.324   2.776 INTRA BF
 185 THR  (  21 ) B    CG2   --  186 GLU  (  22 ) B    N       0.323   2.777 INTRA BF
 180 LYS  (  16 ) B    CG    --  181 ILE  (  17 ) B    N       0.318   2.782 INTRA BF
 173 ILE  (   9 ) B    CG2   --  174 ASP  (  10 ) B    N       0.317   2.783 INTRA
  59 VAL  (  57 ) A    CG1   --   60 ILE  (  58 ) A    N       0.315   2.785 INTRA BF
 232 LEU  (  66 ) B    CA    --  235 GLN  (  69 ) B    NE2     0.310   2.790 INTRA BF
 111 THR  ( 109 ) A    CG2   --  112 GLY  ( 110 ) A    N       0.309   2.791 INTRA BF
   2 ASN  (   2 ) A    CB    --   70 ASN  (  68 ) A    ND2     0.307   2.793 INTER
 190 THR  (  26 ) B    CG2   --  191 ILE  (  27 ) B    N       0.305   2.795 INTRA BF
 220 THR  (  54 ) B    CG2   --  221 ASN  (  55 ) B    N       0.291   2.809 INTRA BF
 323 THR  ( 157 ) B    O     --  325 ASP  ( 159 ) B    N       0.283   2.417 INTRA BF
 317 THR  ( 151 ) B    O     --  320 ARG  ( 154 ) B    N       0.282   2.418 INTRA BF
 308 THR  ( 142 ) B    CA    --  309 PRO  ( 143 ) B    CD      0.281   2.519 INTRA BF
 113 VAL  ( 111 ) A    CG1   --  114 ALA  ( 112 ) A    N       0.279   2.821 INTRA BF
  10 ASP  (  10 ) A    OD1   --  150 ARG  ( 148 ) A    NH2     0.271   2.279 INTRA HB
And so on for a total of 359 lines.

Sect 8) Packing, accessibility and threading

Note: Inside/Outside residue distribution normal

The distribution of residue types over the inside and the outside of the protein is normal.

inside/outside RMS Z-score : 0.929

Note: Inside/Outside RMS Z-score plot

The Inside/Outside distribution normality RMS Z-score over a 15 residue window is plotted as function of the residue number. High areas in the plot (above 1.5) indicate unusual inside/outside patterns.

Chain identifier: A

Note: Inside/Outside RMS Z-score plot

Chain identifier: B

Warning: Abnormal packing environment for some residues

The residues listed in the table below have an unusual packing environment.

The packing environment of the residues is compared with the average packing environment for all residues of the same type in good PDB files. A low packing score can indicate one of several things: Poor packing, misthreading of the sequence through the density, crystal contacts, contacts with a co-factor, or the residue is part of the active site. It is not uncommon to see a few of these, but in any case this requires further inspection of the residue.

 246 ARG  (  80 ) B  -6.48
 199 LYS  (  35 ) B  -5.67
 143 GLN  ( 141 ) A  -5.61
 307 GLN  ( 141 ) B  -5.55
  35 LYS  (  35 ) A  -5.52
 271 GLN  ( 105 ) B  -5.37
 107 GLN  ( 105 ) A  -5.29
 156 ARG  ( 154 ) A  -5.26
 320 ARG  ( 154 ) B  -5.26

Note: No series of residues with bad packing environment

There are no stretches of three or more residues each having a quality control score worse than -4.0.

Note: Structural average packing environment OK

The structural average quality control value is within normal ranges.

Average for range 1 - 328 : -1.024

Note: Quality value plot

The quality value smoothed over a 10 residue window is plotted as function of the residue number. Low areas in the plot (below -2.0) indicate "unusual" packing.

Chain identifier: A

Note: Quality value plot

The quality value smoothed over a 10 residue window is plotted as function of the residue number. Low areas in the plot (below -2.0) indicate "unusual" packing.

Chain identifier: B

Note: Second generation packing environment OK

None of the individual amino acid residues has a bad packing environment.

Note: No series of residues with abnormal new packing environment

There are no stretches of four or more residues each having a quality control Z-score worse than -1.75.

Note: Structural average packing Z-score OK

The structural average for the second generation quality control value is within normal ranges.

All contacts : Average = -0.177 Z-score = -0.80
BB-BB contacts : Average = -0.190 Z-score = -0.92
BB-SC contacts : Average = -0.018 Z-score = -0.16
SC-BB contacts : Average = -0.178 Z-score = -0.80
SC-SC contacts : Average = -0.111 Z-score = -0.35

Note: Second generation quality Z-score plot

The second generation quality Z-score smoothed over a 10 residue window is plotted as function of the residue number. Low areas in the plot (below -1.3) indicate "unusual" packing.

Chain identifier: A

Note: Second generation quality Z-score plot

Chain identifier: B

Sect 9) Water and hydrogenbond related checks

Error: Water clusters without contacts with non-water atoms

The water molecules listed in the table below are part of water molecule clusters that do not make contacts with non-waters. These water molecules are part of clusters that have a distance at least 1 Angstrom larger than the sum of the Van der Waals radii to the nearest non-solvent atom. Because these kinds of water clusters usually are not observed with X-ray diffraction their presence could indicate a refinement artifact. The number in brackets is the identifier of the water molecule in the input file.

 329 HOH  (  11 )
 329 HOH  (  12 )

Warning: Water molecules need moving

The water molecules listed in the table below were found to be significantly closer to a symmetry related non-water molecule than to the ones given in the coordinate file. For optimal viewing convenience revised coordinates for these water molecules should be given.

The number in brackets is the identifier of the water molecule in the input file. Suggested coordinates are also given in the table. Please note that alternative conformations for protein residues are not taken into account for this calculation. If you are using WHAT IF / WHAT-CHECK interactively, then the moved waters can be found in PDB format in the file: MOVED-H2O.pdb.

 329 HOH  (  11 )             -27.543   43.420   17.460
 329 HOH  (  12 )             -27.940   36.120   31.439
 329 HOH  (  16 )              -7.833   15.429   41.757
 329 HOH  (  27 )             -21.772   39.782   38.071

Error: Water molecules without hydrogen bonds

The water molecules listed in the table below do not form any hydrogen bonds, neither with the protein or DNA/RNA, nor with other water molecules. This is a strong indication of a refinement problem. The last number on each line is the identifier of the water molecule in the input file.

 329 HOH  (   5 )
 329 HOH  (  11 )
 329 HOH  (  12 )

Note: Ligand topologies OK

The topology could be determined for all ligands (or there are no ligands for which a topology is needed, in which case there is absolutely no problem, of course). That is good because it means that all ligands can be included in the hydrogen bond optimization and related options.

Error: HIS, ASN, GLN side chain flips

Listed here are Histidine, Asparagine or Glutamine residues for which the orientation determined from hydrogen bonding analysis are different from the assignment given in the input. Either they could form energetically more favorable hydrogen bonds if the terminal group was rotated by 180 degrees, or there is no assignment in the input file (atom type 'A') but an assignment could be made. If a residue is marked `flexible' the flipped conformation is only slightly better than the non-flipped conformation.

  55 ASN  (  53 ) A
 221 ASN  (  55 ) B

Note: Histidine type assignments

For all complete HIS residues in the structure a tentative assignment to HIS-D (protonated on ND1), HIS-E (protonated on NE2), or HIS-H (protonated on both ND1 and NE2, positively charged) is made based on the hydrogen bond network. A second assignment is made based on which of the Engh and Huber [REF] histidine geometries fits best to the structure.

In the table below all normal histidine residues are listed. The assignment based on the geometry of the residue is listed first, together with the RMS Z-score for the fit to the Engh and Huber parameters. For all residues where the H-bond assignment is different, the assignment is listed in the last columns, together with its RMS Z-score to the Engh and Huber parameters.

As always, the RMS Z-scores should be close to 1.0 if the residues were restrained to the Engh and Huber parameters during refinement.

Please note that because the differences between the geometries of the different types are small it is possible that the geometric assignment given here does not correspond to the type used in refinement. This is especially true if the RMS Z-scores are much higher than 1.0.

If the two assignments differ, or the `geometry' RMS Z-score is high, it is advisable to verify the hydrogen bond assignment, check the HIS type used during the refinement and possibly adjust it.

  31 HIS  (  31 ) A     HIS-D   1.04
 195 HIS  (  31 ) B     HIS-D   0.31

Warning: Buried unsatisfied hydrogen bond donors

The buried hydrogen bond donors listed in the table below have a hydrogen atom that is not involved in a hydrogen bond in the optimized hydrogen bond network.

Hydrogen bond donors that are buried inside the protein normally use all of their hydrogens to form hydrogen bonds within the protein. If there are any non hydrogen bonded buried hydrogen bond donors in the structure they will be listed here. In very good structures the number of listed atoms will tend to zero.

Waters are not listed by this option.

   2 ASN  (   2 ) A    N
  12 GLY  (  12 ) A    N
  22 GLU  (  22 ) A    N
  25 TYR  (  25 ) A    N
  25 TYR  (  25 ) A    OH
  34 THR  (  34 ) A    N
  38 SER  (  38 ) A    N
  40 ASN  (  40 ) A    N
  40 ASN  (  40 ) A    ND2
  41 ALA  (  41 ) A    N
  94 ASP  (  92 ) A    N
 103 ASN  ( 101 ) A    ND2
 126 LYS  ( 124 ) A    N
 140 TRP  ( 138 ) A    N
 160 TRP  ( 158 ) A    N
 160 TRP  ( 158 ) A    NE1
 166 ASN  (   2 ) B    N
 178 ARG  (  14 ) B    N
 186 GLU  (  22 ) B    N
 189 TYR  (  25 ) B    N
 202 SER  (  38 ) B    OG
 203 LEU  (  39 ) B    N
 204 ASN  (  40 ) B    N
 222 GLY  (  56 ) B    N
 262 ARG  (  96 ) B    N
 262 ARG  (  96 ) B    NH1
 265 LEU  (  99 ) B    N
 312 ALA  ( 146 ) B    N
 318 THR  ( 152 ) B    OG1

Warning: Buried unsatisfied hydrogen bond acceptors

The buried side-chain hydrogen bond acceptors listed in the table below are not involved in a hydrogen bond in the optimized hydrogen bond network.

Side-chain hydrogen bond acceptors that are buried inside the protein normally form hydrogen bonds within the protein. If there are any not hydrogen bonded in the optimized hydrogen bond network they will be listed here.

Waters are not listed by this option.

 306 ASN  ( 140 ) B    OD1

Final summary

Note: Summary report for users of a structure

This is an overall summary of the quality of the structure as compared with current reliable structures. This summary is most useful for biologists seeking a good structure to use for modelling calculations.

The second part of the table mostly gives an impression of how well the model conforms to common refinement constraint values. The first part of the table shows a number of constraint-independent quality indicators.


Structure Z-scores, positive is better than average:

  1st generation packing quality :  -1.310
  2nd generation packing quality :  -0.796
  Ramachandran plot appearance   :  -6.501 (bad)
  chi-1/chi-2 rotamer normality  :  -5.647 (bad)
  Backbone conformation          :  -1.826

RMS Z-scores, should be close to 1.0:
  Bond lengths                   :   1.113
  Bond angles                    :   1.565
  Omega angle restraints         :   0.093 (tight)
  Side chain planarity           :   1.464
  Improper dihedral distribution :   1.982 (loose)
  Inside/Outside distribution    :   0.929

Note: Summary report for depositors of a structure

This is an overall summary of the quality of the X-ray structure as compared with structures solved at similar resolutions. This summary can be useful for a crystallographer to see if the structure makes the best possible use of the data.

The second part of the table mostly gives an impression of how well the model conforms to common refinement constraint values. The first part of the table shows a number of constraint-independent quality indicators, which have been calibrated against structures of similar resolution.

Resolution found in PDB file : 2.80


Structure Z-scores, positive is better than average:

  1st generation packing quality :  -0.3
  2nd generation packing quality :   0.8
  Ramachandran plot appearance   :  -3.9 (poor)
  chi-1/chi-2 rotamer normality  :  -3.2 (poor)
  Backbone conformation          :  -1.2

RMS Z-scores, should be close to 1.0:
  Bond lengths                   :   1.113
  Bond angles                    :   1.565
  Omega angle restraints         :   0.093 (tight)
  Side chain planarity           :   1.464
  Improper dihedral distribution :   1.982 (loose)
  Inside/Outside distribution    :   0.929
==============

WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).

WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).

Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991).

Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).

DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).

Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).

Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).

Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).

Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).

Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).

Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).

Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files